PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7205_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 324aa    MW: 36129 Da    PI: 6.7733
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7205_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd  lv +v+++G+g+W++++   g++R+ k+c++rw +yl
  cra_locus_7205_iso_5_len_1476_ver_3 14 KGPWTPEEDIMLVSYVQEYGPGNWRAVPTNTGLRRCSKSCRLRWTNYL 61
                                         79********************************************97 PP

2Myb_DNA-binding48.61.9e-1567112148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  cra_locus_7205_iso_5_len_1476_ver_3  67 RGSFTDQEEKMIIQLQALLGNK-WAAIASYLP-ERTDNDIKNYWNTHL 112
                                          89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.751965IPR017930Myb domain
SuperFamilySSF466894.4E-3111108IPR009057Homeodomain-like
SMARTSM007176.4E-151363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
CDDcd001671.76E-111661No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2565117IPR009057Homeodomain-like
SMARTSM007178.3E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.28966116IPR017930Myb domain
PfamPF002491.1E-1467112IPR001005SANT/Myb domain
CDDcd001673.31E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIMLVSYVQ EYGPGNWRAV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGSF TDQEEKMIIQ LQALLGNKWA AIASYLPERT DNDIKNYWNT HLKKKLKMLQ  120
TGPDPCSRNG FSSSQSASKG QWERRLQADI KTAKQALQDA LTLDGTSSPV PDSKGLFSLA  180
ETGGQASNNS NTYASSTENI ARLLKDWARN SSNSKSKKQS KSSSTQHSFN YPANEYSTSS  240
SVESKNGIEL SEAFESLFGF ESFDSSNSEF SQSTSPEASL FQGESKPEIT QVPLAMLENW  300
LFDESSIQGK DLTNFSFDHD EDLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-271411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-271411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C4e-281411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629125.11e-140PREDICTED: myb-related protein 306-like
RefseqXP_016432585.11e-140PREDICTED: myb-related protein 306-like
SwissprotP813921e-116MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A068U1291e-141A0A068U129_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00830.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154